Structure of PDB 7pir Chain C

Receptor sequence

>7pirC (length=203) Species: 272634 (Mycoplasmoides pneumoniae M129)

MKYTGSIFKRSRRLGFSLLENNKEFSKGKKRKTIPGQHGNRFRSSTMSGY
AQQLQEKQRMQYMYGITDKQFRRLFRLVLKQRGNLAVNLFRVLESRLDNI
VYRMGFAPTRRSARQLVNHGHVLLNDRTVDTPSIILNPGDKVRLKAKTIK
IPIVKAASESGVVSPFVETNNKTFEGTYVRFPERSELPAGINESYVVEWY
KRL

3D structure

• PDB: 7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: C
• Resolution: 12.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	M1 K2 Y3 G5 S6 F8 K9 R10 R12 R13 N22 K27 G28 K29 R31 P35 G36 Q37 H38 S45 T46 L54 Q58 Y62 T67 D68 K69 Q70 R73 K80 R82 R96 P108 T109 R111 S112 R114 Q115 N118 H119 H121 N125 R127 V129 T131 P132 S133 I134 K147 I151 P152 I153 W199 Y200 K201 R202 L203	M1 K2 Y3 G5 S6 F8 K9 R10 R12 R13 N22 K27 G28 K29 R31 P35 G36 Q37 H38 S45 T46 L54 Q58 Y62 T67 D68 K69 Q70 R73 K80 R82 R96 P108 T109 R111 S112 R114 Q115 N118 H119 H121 N125 R127 V129 T131 P132 S133 I134 K147 I151 P152 I153 W199 Y200 K201 R202 L203

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pir, PDBe:7pir, PDBj:7pir
• PDBsum: 7pir
• PubMed: 36171285
• UniProt: P46775|RS4_MYCPN Small ribosomal subunit protein uS4 (Gene Name=rpsD)