Structure of PDB 7phb Chain C

Receptor sequence

>7phbC (length=203) Species: 272634 (Mycoplasmoides pneumoniae M129)

MKYTGSIFKRSRRLGFSLLENNKEFSKGKKRKTIPGQHGNRFRSSTMSGY
AQQLQEKQRMQYMYGITDKQFRRLFRLVLKQRGNLAVNLFRVLESRLDNI
VYRMGFAPTRRSARQLVNHGHVLLNDRTVDTPSIILNPGDKVRLKAKTIK
IPIVKAASESGVVSPFVETNNKTFEGTYVRFPERSELPAGINESYVVEWY
KRL

3D structure

• PDB: 7phb Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: C
• Resolution: 4.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	M1 K2 Y3 S6 F8 K9 R10 R13 K27 G28 K29 R31 G36 H38 F42 S45 Y50 A51 L54 Q58 D68 K69 Q70 R73 K80 T109 R111 S112 R114 Q115 N118 H119 V129 D130 P132 I151 P152 K201 R202	M1 K2 Y3 S6 F8 K9 R10 R13 K27 G28 K29 R31 G36 H38 F42 S45 Y50 A51 L54 Q58 D68 K69 Q70 R73 K80 T109 R111 S112 R114 Q115 N118 H119 V129 D130 P132 I151 P152 K201 R202

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7phb, PDBe:7phb, PDBj:7phb
• PDBsum: 7phb
• PubMed: 36171285
• UniProt: P46775|RS4_MYCPN Small ribosomal subunit protein uS4 (Gene Name=rpsD)