Structure of PDB 7ph2 Chain C |
>7ph2C (length=111) Species: 30538 (Vicugna pacos) [Search protein sequence] |
QMQLVESGGGLVQAGGSLRLSCAVSGSIFSIITLAWYRQAPGKPRENVAT ITRGSRTSYCDSVKGRFTISKDNAKSTVYLQMNKLKPEDTADYYCNAEGP AGYWGQGTPVT |
|
PDB | 7ph2 The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells. |
Chain | C |
Resolution | 3.7 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
88T |
C |
C60 S62 |
C60 S62 |
|
|
|