Structure of PDB 7p3f Chain C

Receptor sequence
>7p3fC (length=147) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence]
MHCPFCRHPDSRVVDSRTTDDGTSIRRRRQCPDCSRRFTTVETCSLMVVK
RSGVTEPFSRTKVINGVRKACQGRPVTEDALAQLGQRVEEAVRATGSAEL
TTHDVGLAILGPLQELDLVAYLRFASVYRAFDSLEDFEAAIAELRET
3D structure
PDB7p3f A nucleotide-sensing oligomerization mechanism that controls NrdR-dependent transcription of ribonucleotide reductases.
ChainC
Resolution3.31 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R28 R37 R28 R37
BS02 dna C R12 S16 R17 R27 R12 S16 R17 R27
BS03 ATP C K50 R51 E56 F58 S59 T102 K50 R51 E56 F58 S59 T102
BS04 DTP C K50 K62 G66 K69 A70 R123 F124 V127 Y128 K50 K62 G66 K69 A70 R123 F124 V127 Y128
BS05 ZN C C3 C31 C3 C31
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7p3f, PDBe:7p3f, PDBj:7p3f
PDBsum7p3f
PubMed35577776
UniProtO69980|NRDR_STRCO Transcriptional repressor NrdR (Gene Name=nrdR)

[Back to BioLiP]