Structure of PDB 7oyd Chain C

Receptor sequence

>7oydC (length=358) Species: 9986 (Oryctolagus cuniculus)

ACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQP
YAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM
FAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELP
LVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRR
IQRRGPCVIYNEDNGIVKAFRNIPGITLLNVTKLNILKLAPGGHVGRFCI
WTESAFRKLDDLYGTWRKAASLKSNYNLPMHKMLNTDLSRILKSPEIQRA
LRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRV
ERAAAALA

3D structure

• PDB: 7oyd A molecular network of conserved factors keeps ribosomes dormant in the egg.
• Chain: C
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	A2 C3 A4 R5 P6 K29 R33 N38 F39 T42 N43 R45 K46 N47 N48 R49 Q50 Y52 V54 S55 A58 H60 Q61 T62 S63 T69 G70 A72 V73 A74 R75 P77 R80 G83 T84 R86 Q89 N94 M95 C96 R97 G98 R100 M101 F102 A103 K106 W108 R109 R110 R114 N116 T117 T118 Q119 K120 R121 K140 K163 T164 K165 K172 N178 K181 K182 Y184 R188 M189 R190 A191 G192 K193 K195 M196 R197 R199 R201 R204 R205 K219 R222 N223 L235 N236 K239 P242 G243 H245 W267 R268 K274 S275 M281 H282 R291 K294 R303 A304 P305 R306 K307 K308 H310 R311 R312 L314 K316 N317 N321 L322 R323 L326 K327 X333 R336 T339 Q343 N346 H347 R350	A1 C2 A3 R4 P5 K28 R32 N37 F38 T41 N42 R44 K45 N46 N47 R48 Q49 Y51 V53 S54 A57 H59 Q60 T61 S62 T68 G69 A71 V72 A73 R74 P76 R79 G82 T83 R85 Q88 N93 M94 C95 R96 G97 R99 M100 F101 A102 K105 W107 R108 R109 R113 N115 T116 T117 Q118 K119 R120 K139 K162 T163 K164 K171 N177 K180 K181 Y183 R187 M188 R189 A190 G191 K192 K194 M195 R196 R198 R200 R203 R204 K218 R221 N222 L234 N235 K238 P241 G242 H244 W266 R267 K273 S274 M280 H281 R290 K293 R302 A303 P304 R305 K306 K307 H309 R310 R311 L313 K315 N316 N320 L321 R322 L325 K326 X332 R335 T338 Q342 N345 H346 R349
BS02	rna	C	P51 A53 S55 K195 M196	P50 A52 S54 K194 M195
BS03	peptide	C	W67 R71 G82 G83 T84 H85 S87 Q89	W66 R70 G81 G82 T83 H84 S86 Q88

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oyd, PDBe:7oyd, PDBj:7oyd
• PDBsum: 7oyd
• PubMed: 36653451
• UniProt: G1SVW5|RL4_RABIT Large ribosomal subunit protein uL4 (Gene Name=RPL4)