Structure of PDB 7oqe Chain C

Receptor sequence
>7oqeC (length=195) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
RYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHK
RRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSI
DTLKLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANEKSAHHSFKQT
SRSRDETCESNPFPRLNNPKKLEPPKILSQWSNTIPKTSIFYSVD
3D structure
PDB7oqe Structural insights into how Prp5 proofreads the pre-mRNA branch site.
ChainC
Resolution5.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C G27 K28 A140 G25 K26 A138
BS02 rna C H15 N40 H55 G57 K58 R59 K74 V75 C77 L78 S79 N80 K81 M87 H13 N38 H53 G55 K56 R57 K72 V73 C75 L76 S77 N78 K79 M85
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0008270 zinc ion binding
GO:0030619 U1 snRNA binding
GO:0030627 pre-mRNA 5'-splice site binding
GO:0046872 metal ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oqe, PDBe:7oqe, PDBj:7oqe
PDBsum7oqe
PubMed34349264
UniProtQ05900|RU1C_YEAST U1 small nuclear ribonucleoprotein C (Gene Name=YHC1)

[Back to BioLiP]