Structure of PDB 7of2 Chain C

Receptor sequence

>7of2C (length=401) Species: 9606 (Homo sapiens)

GTQRVCLVHPDVWQVAEATALVHTLDGWSVVQTMVVSTKTPDRKLIFGKG
NFEHLTEKIRGSPDITCVFLNVERMAAPTKKELEAAWGVEVFDRFTVVLH
IFRCNARTKEARLQVALAEMPLHRSNLKRDVAHLYRGVGSRYIMGSGESF
MQLQQRLLREKEAKIRKALDRLRKKRHLLRRQRTRREFPVISVVGYTNCG
KTTLIKALTGDAAIQPRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQ
LPHGLIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLP
APLLDSMVEVHNKVDLVNVVPVSALRGHGLQELKAELDAAVLKATGRQIL
TLRVRLAGAQLSWLYKEATVQEVDVIPEDGAADVRVIISNSAYGKFRKLF
P

3D structure

• PDB: 7of2 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
• Chain: C
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	D148 R149 K150 R213 K215 R218 Y241 R242 G243 S246 R247 Y248 I249 M250 G251 G253 M257 L263 L285 R287 Q288 R289 R291 R292 F294 A334 L346 S505 G508 K509 K512	D42 R43 K44 R107 K109 R112 Y135 R136 G137 S140 R141 Y142 I143 M144 G145 G147 M151 L157 L179 R181 Q182 R183 R185 R186 F188 A228 L240 S391 G394 K395 K398
BS02	GTP	C	T303 N304 G306 K307 T308 T309 P322 R323 F327 A328 T329 N418 K419 D421 L422 S437 A438 L439	T197 N198 G200 K201 T202 T203 P216 R217 F221 A222 T223 N312 K313 D315 L316 S323 A324 L325
BS03	MG	C	T308 T329	T202 T223

Gene Ontology

Molecular Function

• GO:0005525 GTP binding
• GO:0043022 ribosome binding
• GO:0046872 metal ion binding

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion

External links

• PDB: RCSB:7of2, PDBe:7of2, PDBj:7of2
• PDBsum: 7of2
• PubMed: 34135319
• UniProt: O43824|GTPB6_HUMAN Putative GTP-binding protein 6 (Gene Name=GTPBP6)