Structure of PDB 7o3c Chain C

Receptor sequence
>7o3cC (length=379) Species: 10090 (Mus musculus) [Search protein sequence]
TNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFL
AMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRG
LYYGSYTFMETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLS
AIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLH
ETGSNNPTGLNSDADKIPFHPYYTIKDILGILIMFLILMTLVLFFPDMLG
DPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALILSILIL
ALMPFLHTSKQRSLMFRPITQILYWILVANLLILTWIGGQPVEHPFIIIG
QLASISYFSIILILMPISGIIEDKMLKLY
3D structure
PDB7o3c Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
ChainC
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM C Q44 G48 L51 R80 H83 A87 A127 G130 L133 H182 F183 P186 Q43 G47 L50 R79 H82 A86 A126 G129 L132 H181 F182 P185
BS02 HEM C W31 L37 L94 H97 V98 R100 S106 W113 G116 L119 H196 L200 S205 N206 W30 L36 L93 H96 V97 R99 S105 W112 G115 L118 H195 L199 S204 N205
Gene Ontology
Molecular Function
GO:0008121 ubiquinol-cytochrome-c reductase activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
Biological Process
GO:0001666 response to hypoxia
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0007584 response to nutrient
GO:0009410 response to xenobiotic stimulus
GO:0009636 response to toxic substance
GO:0009725 response to hormone
GO:0014070 response to organic cyclic compound
GO:0015990 electron transport coupled proton transport
GO:0022904 respiratory electron transport chain
GO:0031100 animal organ regeneration
GO:0033590 response to cobalamin
GO:0033762 response to glucagon
GO:0045333 cellular respiration
GO:0045471 response to ethanol
GO:0046686 response to cadmium ion
GO:0046688 response to copper ion
GO:0046689 response to mercury ion
GO:0051592 response to calcium ion
GO:0055093 response to hyperoxia
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0045275 respiratory chain complex III

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o3c, PDBe:7o3c, PDBj:7o3c
PDBsum7o3c
PubMed34616041
UniProtP00158|CYB_MOUSE Cytochrome b (Gene Name=Mt-Cyb)

[Back to BioLiP]