Structure of PDB 7o35 Chain C

Receptor sequence

>7o35C (length=111) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2)

ASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQ
IAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILL
NKHIDAYKTFP

3D structure

• PDB: 7o35 Identification of a guanine-specific pocket in the protein N of SARS-CoV-2.
• Chain: C
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	C	R259 R262 W330	R6 R9 W77

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Cellular Component

• GO:0019013 viral nucleocapsid

External links

• PDB: RCSB:7o35, PDBe:7o35, PDBj:7o35
• PDBsum: 7o35
• PubMed: 35842466
• UniProt: P0DTC9|NCAP_SARS2 Nucleoprotein (Gene Name=N)