Structure of PDB 7nwi Chain C

Receptor sequence

>7nwiC (length=361) Species: 9986 (Oryctolagus cuniculus)

ACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQP
YAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM
FAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELP
LVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRR
IQRRGPCVIYNEDNGIVKAFRNIPGITLLNVTKLNILKLAPGGHVGRFCI
WTESAFRKLDDLYGTWRKAASLKSNYNLPMHKMLNTDLSRILKSPEIQRA
LRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRV
ERAAAALAAKS

3D structure

• PDB: 7nwi Blasticidin S inhibits mammalian translation and enhances production of protein encoded by nonsense mRNA.
• Chain: C
• Resolution: 3.13 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	A2 R33 N38 T42 R45 N48 R49 Q50 V54 S55 A58 H60 T62 S63 S66 T69 G70 R71 V73 R75 I76 P77 R80 G83 Q89 N94 M95 R97 R100 M101 F102 R114 N116 K120 R121 R143 K163 T164 K165 K172 K181 K182 Y184 A185 R188 R190 A191 G192 K195 M196 R197 R199 R201 R204 R205 K219 R222 N223 K239 G243 H245 R268 K274 S275 R291 R303 P305 R306 K307 K308 H310 R311 R312 K316 K320 N321 R323 L326 K327 K333 R342 Q343 N346 R350 R353	A1 R32 N37 T41 R44 N47 R48 Q49 V53 S54 A57 H59 T61 S62 S65 T68 G69 R70 V72 R74 I75 P76 R79 G82 Q88 N93 M94 R96 R99 M100 F101 R113 N115 K119 R120 R142 K162 T163 K164 K171 K180 K181 Y183 A184 R187 R189 A190 G191 K194 M195 R196 R198 R200 R203 R204 K218 R221 N222 K238 G242 H244 R267 K273 S274 R290 R302 P304 R305 K306 K307 H309 R310 R311 K315 K319 N320 R322 L325 K326 K332 R341 Q342 N345 R349 R352
BS02	rna	C	K195 M196	K194 M195

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 22:56:57 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7nwi', asym_id = 'C', title = 'Blasticidin S inhibits mammalian translation and...s production of protein encoded by nonsense mRNA.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7nwi', asym_id='C', title='Blasticidin S inhibits mammalian translation and...s production of protein encoded by nonsense mRNA.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7nwi', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7nwi', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>