Structure of PDB 7nka Chain C |
>7nkaC (length=249) Species: 88776 (Influenza A virus (A/Brevig Mission/1/1918(H1N1))) [Search protein sequence] |
MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWM MAMKYPITADKRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWN RNGPTTSAVHYPKIYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPG HADLSAKEAQDVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKISP LMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPGGE |
|
PDB | 7nka Mapping inhibitory sites on the RNA polymerase of the 1918 pandemic influenza virus using nanobodies. |
Chain | C |
Resolution | 4.07 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
C |
S36 R38 R46 |
S36 R38 R46 |
|
|
|
Biological Process |
GO:0001172 |
RNA-templated transcription |
GO:0006351 |
DNA-templated transcription |
GO:0006370 |
7-methylguanosine mRNA capping |
GO:0019049 |
virus-mediated perturbation of host defense response |
GO:0019083 |
viral transcription |
GO:0039523 |
symbiont-mediated suppression of host mRNA transcription via inhibition of RNA polymerase II activity |
GO:0039545 |
symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity |
GO:0039694 |
viral RNA genome replication |
GO:0075526 |
cap snatching |
|
|