Structure of PDB 7mt2 Chain C

Receptor sequence

>7mt2C (length=272) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]

AIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRITT
RHKGGGHKRAYRMIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGE
KRYIIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGG
GAKLARSAGSSIQLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAEQ
ANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWG
KPEGRTRNANKSSNKFIVRRRR

3D structure

PDB

7mt2 Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.

Chain

Resolution

2.76 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R4 P8 T10 P11 R13 R14 F21 K31 H38 G39 R40 G42 R43 N44 A45 H46 G47 R48 I49 T50 T51 R52 K54 G56 H58 K59 R60 Y62 R63 R68 Y84 P86 R88 D99 G100 L147 R148 G151 K154 L155 A156 R157 S158 A159 M177 S179 R183 Q201 A202 N205 W206 K208 A209 G210 R211 R213 W214 R218 P219 S220 V221 R222 G223 V224 V225 M226 N227 V229 D230 H233 G236 E237 G238 K239 T240 S241 G243 R244 H245 P246 P249 W250 G255 R256 T257 R258 K262 R271 R272	R3 P7 T9 P10 R12 R13 F20 K30 H37 G38 R39 G41 R42 N43 A44 H45 G46 R47 I48 T49 T50 R51 K53 G55 H57 K58 R59 Y61 R62 R67 Y83 P85 R87 D98 G99 L146 R147 G150 K153 L154 A155 R156 S157 A158 M176 S178 R182 Q200 A201 N204 W205 K207 A208 G209 R210 R212 W213 R217 P218 S219 V220 R221 G222 V223 V224 M225 N226 V228 D229 H232 G235 E236 G237 K238 T239 S240 G242 R243 H244 P245 P248 W249 G254 R255 T256 R257 K261 R270 R271
BS02	rna	C	R176 N203 R270	R175 N202 R269

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0005886	plasma membrane
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7mt2, PDBe:7mt2, PDBj:7mt2
PDBsum	7mt2
PubMed	35064151
UniProt	P9WHA5\|RL2_MYCTU Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]