Structure of PDB 7mig Chain C

Receptor sequence

>7migC (length=533) Species: 9606 (Homo sapiens)

MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTF
SPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINK
ERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGT
VGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNS
VRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSI
YRVPLLLEEQGVVDYFLRRLDLPLMKWKEMADRYDRLLETCSIALVGKYD
SYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLC
SAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRN
VLGWQDANSTEFDPTTSHPVVVDMPEHTMRLGKRRTLFQTKNSVMRKLYG
DADYLEERHRHRFEVNPVWKKCLLKFVGQDVEGERMEIVELEDHPFFVGV
QYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQ

3D structure

• PDB: 7mig Structural basis for isoform-specific inhibition of human CTPS1.
• Chain: C
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 6.3.4.2: CTP synthase (glutamine hydrolyzing).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZFY	C	I18 R76 F77 R217 H245 V247 S249 I250 V253 W285 Y292 K319 E322 H323 P533	I18 R76 F77 R217 H245 V247 S249 I250 V253 W277 Y284 K307 E310 H311 P510
BS02	GLN	C	G371 G372 F373 C399 Q403 E423 R479 H480 R481 F482	G359 G360 F361 C387 Q391 E411 R460 H461 R462 F463
BS03	UTP	C	K193 T194 K195 K229	K193 T194 K195 K229
BS04	UTP	C	S12 K38 D40 P41 H55 G148 G149	S12 K38 D40 P41 H55 G148 G149

Gene Ontology

Molecular Function

• GO:0003883 CTP synthase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0002376 immune system process
• GO:0006139 nucleobase-containing compound metabolic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0006241 CTP biosynthetic process
• GO:0006541 glutamine metabolic process
• GO:0009410 response to xenobiotic stimulus
• GO:0019637 organophosphate metabolic process
• GO:0019856 pyrimidine nucleobase biosynthetic process
• GO:0042098 T cell proliferation
• GO:0042100 B cell proliferation
• GO:0044210 'de novo' CTP biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0097268 cytoophidium

External links

• PDB: RCSB:7mig, PDBe:7mig, PDBj:7mig
• PDBsum: 7mig
• PubMed: 34583994
• UniProt: P17812|PYRG1_HUMAN CTP synthase 1 (Gene Name=CTPS1)