Structure of PDB 7mif Chain C

Receptor sequence

>7mifC (length=533) Species: 9606 (Homo sapiens)

MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTF
SPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINK
ERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGT
VGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNS
VRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSI
YRVPLLLEEQGVVDYFLRRLDLPLMKWKEMADRYDRLLETCSIALVGKYD
SYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLC
SAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRN
VLGWQDANSTEFDPTTSHPVVVDMPEHTMRLGKRRTLFQTKNSVMRKLYG
DADYLEERHRHRFEVNPVWKKCLLKFVGQDVEGERMEIVELEDHPFFVGV
QYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQ

3D structure

• PDB: 7mif Structural basis for isoform-specific inhibition of human CTPS1.
• Chain: C
• Resolution: 3.1 Å

Enzymatic activity

• Enzyme Commision number: 6.3.4.2: CTP synthase (glutamine hydrolyzing).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLN	C	G371 G372 F373 C399 L400 Q403 H480 R481 F482 H526	G359 G360 F361 C387 L388 Q391 H461 R462 F463 H503
BS02	ZG4	C	G15 I19 R76 F77 R217 V247 I250 V253 W285 K319 E322 H323 P533	G15 I19 R76 F77 R217 V247 I250 V253 W277 K307 E310 H311 P510
BS03	UTP	C	K193 T194 K195 Q198	K193 T194 K195 Q198
BS04	UTP	C	S12 K38 D40 P41 Y42 H55 G148 G149	S12 K38 D40 P41 Y42 H55 G148 G149

Gene Ontology

Molecular Function

• GO:0003883 CTP synthase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0002376 immune system process
• GO:0006139 nucleobase-containing compound metabolic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0006241 CTP biosynthetic process
• GO:0006541 glutamine metabolic process
• GO:0009410 response to xenobiotic stimulus
• GO:0019637 organophosphate metabolic process
• GO:0019856 pyrimidine nucleobase biosynthetic process
• GO:0042098 T cell proliferation
• GO:0042100 B cell proliferation
• GO:0044210 'de novo' CTP biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0097268 cytoophidium

External links

• PDB: RCSB:7mif, PDBe:7mif, PDBj:7mif
• PDBsum: 7mif
• PubMed: 34583994
• UniProt: P17812|PYRG1_HUMAN CTP synthase 1 (Gene Name=CTPS1)