Structure of PDB 7m4y Chain C

Receptor sequence

>7m4yC (length=272) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]

PIQKCKPTSPGRRFVEKVVHDHLHKGAPYAPLVEAKKRTGGRNNNGHITT
RHVGGGHKQHYRIVDFKRNKDGVPAVVERIEYDPNRTAHIALLKYADGER
RYIIAPKGLRAGDKVQSGNDAPIRPGNCLPLRNMPIGSTLHNVELKIGKG
AQLARSAGASVQLLGRDGSYAIIRLRSGEMRKVHVECRAVIGEVSNQENN
LRSLGKAGAARWRGVRPTVRGMAMNPIDHPHGGGEGRNKGIQPVSPWGQK
AKGYKTRTNKRTTKMIIRDRRV

3D structure

PDB

7m4y Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	K7 P8 T9 S10 G12 R13 R14 F15 E35 K38 R39 G42 R43 N44 N45 N46 G47 H48 I49 T50 T51 R52 H53 G56 H58 K59 Q60 H61 Y62 R63 K68 Y83 R87 A97 D98 R101 K147 I148 K150 Q153 L154 A155 R156 S157 A158 Y171 L176 R177 S178 E180 R182 Q198 N201 L205 G206 K207 A208 G209 R212 W213 R217 P218 T219 V220 R221 G222 M223 A224 M225 N226 I228 D229 H232 G235 E236 R238 N239 K240 G241 I242 Q243 P244 P247 W248 Q250 K251 A252 K253 G254 Y255 K256 T257 R258 R262 T263 R271 V273	K6 P7 T8 S9 G11 R12 R13 F14 E34 K37 R38 G41 R42 N43 N44 N45 G46 H47 I48 T49 T50 R51 H52 G55 H57 K58 Q59 H60 Y61 R62 K67 Y82 R86 A96 D97 R100 K146 I147 K149 Q152 L153 A154 R155 S156 A157 Y170 L175 R176 S177 E179 R181 Q197 N200 L204 G205 K206 A207 G208 R211 W212 R216 P217 T218 V219 R220 G221 M222 A223 M224 N225 I227 D228 H231 G234 E235 R237 N238 K239 G240 I241 Q242 P243 P246 W247 Q249 K250 A251 K252 G253 Y254 K255 T256 R257 R261 T262 R270 V272

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7m4y, PDBe:7m4y, PDBj:7m4y
PDBsum	7m4y
PubMed	34044590
UniProt	B7IA36\|RL2_ACIB5 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]