Structure of PDB 7m1x Chain C

Receptor sequence
>7m1xC (length=103) Species: 10090 (Mus musculus) [Search protein sequence]
AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEV
LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHK
SLI
3D structure
PDB7m1x Structural basis of chromatin regulation by histone variant H2A.Z.
ChainC
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C A816 V817 S818 R819 R831 R834 R880 A1 V2 S3 R4 R16 R19 R65
BS02 dna C R831 K837 R845 V846 G847 A848 V878 K879 R880 R16 K22 R30 V31 G32 A33 V63 K64 R65
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031490 chromatin DNA binding
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0071392 cellular response to estradiol stimulus
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0000792 heterochromatin
GO:0001740 Barr body
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m1x, PDBe:7m1x, PDBj:7m1x
PDBsum7m1x
PubMed34643712
UniProtP0C0S6|H2AZ_MOUSE Histone H2A.Z (Gene Name=H2az1)

[Back to BioLiP]