Structure of PDB 7lv1 Chain C

Receptor sequence

>7lv1C (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLED
KSPDSPEMWHFRHGFDHLVGHIDDALKLANEGKVKEAQAAAEQLKCHCNH
CHQHYR

3D structure

• PDB: 7lv1 Overcoming universal restrictions on metal selectivity by protein design.
• Chain: C
• Resolution: 1.91 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	C	E4 M7 E8 L10 N11 P46 F61 F65 C98 C101 H102 Y105 R106	E4 M7 E8 L10 N11 P46 F61 F65 C98 C101 H102 Y105 R106
BS02	CU	C	H67 H71	H67 H71

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:7lv1, PDBe:7lv1, PDBj:7lv1
• PDBsum: 7lv1
• PubMed: 35236987
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)