Structure of PDB 7l0g Chain C |
>7l0gC (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] |
SVPTKLEVVAATPTSLLISWDAPAVTVFFYVITYGETGHGVGAFQAFKVP GSKSTATISGLKPGVDYTITVYARGYSKQGPYKPSPISINYRT |
|
PDB | 7l0g Selective and noncovalent targeting of RAS mutants for inhibition and degradation. |
Chain | C |
Resolution | 2.54 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GSP |
C |
V43 G44 F46 |
V41 G42 F44 |
|
|
|