Structure of PDB 7k78 Chain C

Receptor sequence

>7k78C (length=101) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEI
LELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIH
Q

3D structure

PDB

7k78 Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	S16 R19 R31 R34 R79	S2 R5 R17 R20 R65
BS02	dna	C	R31 R44 I45 G46 S47 K77 T78 R79	R17 R30 I31 G32 S33 K63 T64 R65

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0031492	nucleosomal DNA binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006281	DNA repair
GO:0006325	chromatin organization
GO:0031507	heterochromatin formation

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex

External links

PDB	RCSB:7k78, PDBe:7k78, PDBj:7k78
PDBsum	7k78
PubMed	33741944
UniProt	P04911\|H2A1_YEAST Histone H2A.1 (Gene Name=HTA1)