Structure of PDB 7e5e Chain C

Receptor sequence

>7e5eC (length=332) Species: 9606 (Homo sapiens)

RATHRLLLLGAGESGKSTIVKQMRILHVNGFNGKATKVQDIKNNLKEAIE
TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALW
EDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLT
SGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYN
MVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAG
KSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTAHYC
YPHFTCAVDTENIRRVFNDCRDIIQRMHLRQY

3D structure

• PDB: 7e5e State-selective modulation of heterotrimeric G alpha s signaling with macrocyclic peptides.
• Chain: C
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	L63 V65	L26 V28
BS02	peptide	C	L46 R228 D229 E230 R231 W234 I257 E268 N271 L272 S275 I276	L9 R174 D175 E176 R177 W180 I203 E214 N217 L218 S221 I222
BS03	peptide	C	L203 R258 E259	L149 R204 E205
BS04	GDP	C	E50 S51 G52 K53 S54 T55 D173 R199 R201 N292 K293 D295 L296 C365 A366 V367	E13 S14 G15 K16 S17 T18 D119 R145 R147 N238 K239 D241 L242 C306 A307 V308

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding
• GO:0019001 guanyl nucleotide binding
• GO:0031683 G-protein beta/gamma-subunit complex binding

Biological Process

• GO:0007165 signal transduction
• GO:0007186 G protein-coupled receptor signaling pathway

External links

• PDB: RCSB:7e5e, PDBe:7e5e, PDBj:7e5e
• PDBsum: 7e5e
• PubMed: 36170854
• UniProt: P63092|GNAS2_HUMAN Guanine nucleotide-binding protein G(s) subunit alpha isoforms short (Gene Name=GNAS)