Structure of PDB 7dug Chain C

Receptor sequence

>7dugC (length=206) Species: 300852 (Thermus thermophilus HB8)

GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAG
LARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVAL
NVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKV
IVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAY
IFLGEV

3D structure

• PDB: 7dug Crystal structure of the Thermus thermophilus (HB8) 30S ribosomal subunit with mRNA and cognate transfer RNA anticodon stem-loop and sisomicin derivative N1''TFMS bound
• Chain: C
• Resolution: 3.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	G2 N3 K4 I5 K27 R127 S154 R156 Q162 W167 R172 V173 P174 L175 H176 T177 L178 R179 F186 R190 T192 V195 K199	G1 N2 K3 I4 K26 R126 S153 R155 Q161 W166 R171 V172 P173 L174 H175 T176 L177 R178 F185 R189 T191 V194 K198
BS02	MG	C	A129 V130	A128 V129
BS03	MG	C	P114 F186	P113 F185
BS04	MG	C	R179 A180 N181 I182	R178 A179 N180 I181

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7dug, PDBe:7dug, PDBj:7dug
• PDBsum: 7dug
• UniProt: P80372|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)