Structure of PDB 7dlk Chain C

Receptor sequence

>7dlkC (length=363) Species: 1423 (Bacillus subtilis)

MEEQIVPFYGKHQAGITTAHQTYVYFAALDVTAKEKSDIITLFRNWTSLT
QMLTSGKKMSAEQRNQYLPPQDTGESADLSPSNLTVTFGFGPSFFEKDGK
DRFGLKSKKPKHLAALPAMPNDNLDEKQGGGDICIQVCADDEQVAFHALR
NLLNQAVGTCEVRFVNKGFLSGGKNGETPRNLFGFKDGTGNQSTEDDSLM
NSIVWVQSGEPDWMTGGTYMAFRKIKMFLEIWDRSSLKDQEDTFGRRKSS
GAPFGQKKETDPVKLNQIPSNSHVSLAKSTGKQILRRAFSYTEGLDPKTG
YMDAGLLFISFQKNPDNQFIPMLKALSAKDALNEYTQTIGSALYACPGGC
KKGEYIAQRLLES

3D structure

• PDB: 7dlk Structure of dye-decolorizing peroxidase from Bacillus subtilis in complex with veratryl alcohol.
• Chain: C
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 1.11.1.-
  4.98.1.1: protoporphyrin ferrochelatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	N181 K186 G188 T189 G190 I225 M227 F244 H273 A277 K278 R286 L306 F308 F319 M322 L326 L332	N181 K186 G188 T189 G190 I225 M227 F244 H273 A277 K278 R286 L306 F308 F319 M322 L326 L332
BS02	OXY	C	D187 R286	D187 R286
BS03	VOH	C	H20 P179 D187 G188 R286 R287 A288	H20 P179 D187 G188 R286 R287 A288

Gene Ontology

Molecular Function

• GO:0004325 ferrochelatase activity
• GO:0004601 peroxidase activity
• GO:0016829 lyase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0033212 iron import into cell
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005576 extracellular region
• GO:0005829 cytosol
• GO:0005886 plasma membrane

External links

• PDB: RCSB:7dlk, PDBe:7dlk, PDBj:7dlk
• PDBsum: 7dlk
• PubMed: 34687768
• UniProt: P39597|EFEB_BACSU Deferrochelatase (Gene Name=efeB)