Structure of PDB 7d0j Chain C

Receptor sequence

>7d0jC (length=80) Species: 3055 (Chlamydomonas reinhardtii)

AHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKASQMASAPRTEDCVGC
KRCETACPTDFLSVRVYLGSESTRSMGLSY

3D structure

• PDB: 7d0j Structure of photosystem I-LHCI-LHCII from the green alga Chlamydomonas reinhardtii in State 2.
• Chain: C
• Resolution: 3.42 Å

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	C	C21 P22 V25 C48 G50 C51 K52 C54 V67	C20 P21 V24 C47 G49 C50 K51 C53 V66
BS02	SF4	C	C11 I12 G13 C14 C17 C58 P59	C10 I11 G12 C13 C16 C57 P58

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009522 photosystem I
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:7d0j, PDBe:7d0j, PDBj:7d0j
• PDBsum: 7d0j
• PubMed: 33597543
• UniProt: Q00914|PSAC_CHLRE Photosystem I iron-sulfur center (Gene Name=psaC)