Structure of PDB 7crp Chain C |
>7crpC (length=109) Species: 8355 (Xenopus laevis) [Search protein sequence] |
TRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLP NIQSVLLPK |
|
PDB | 7crp Molecular basis of nucleosomal H3K36 methylation by NSD methyltransferases. |
Chain | C |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
C |
T10 V43 T76 |
T1 V34 T67 |
|
|
|
|