Structure of PDB 7cby Chain C

Receptor sequence
>7cbyC (length=100) Species: 9606 (Homo sapiens) [Search protein sequence]
PKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQ
NSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRR
3D structure
PDB7cby Structural Basis for DNA Recognition by FOXG1 and the Characterization of Disease-causing FOXG1 Mutations.
ChainC
Resolution1.646 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C L204 R230 H231 S234 K241 N253 W255 K272 L28 R54 H55 S58 K65 N77 W79 K96
BS02 dna C S185 Y186 N227 S228 H231 K272 S9 Y10 N51 S52 H55 K96
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7cby, PDBe:7cby, PDBj:7cby
PDBsum7cby
PubMed33058871
UniProtP55316|FOXG1_HUMAN Forkhead box protein G1 (Gene Name=FOXG1)

[Back to BioLiP]