Structure of PDB 7c9r Chain C

Receptor sequence

>7c9rC (length=311) Species: 631362 (Thiorhodovibrio frisius) [Search protein sequence]

CDFPPQDVVQTGYRGLGMQQNYNPKLLQKVIDATQVPDAIPAATPGGALA
KDVYKNVQVLGDLSVNEFNRTMVALTTWVAPNEGCTYCHEGTNWESDGVY
TKIASRRMLEMTRDTNSNWTGHVADTGVTCYTCHRGKPVPEHVWTTDPGP
DIPSVFPSNGQNTIGYNVAYTALPFDPFTPFLLGENEIRVSGNTDLRNTN
RKSIKQAEWTFALMTHFSEALGVNCTYCHNSRAFMDWNQSTPKRVPAWHA
IRNVRDINIQYVEPLGEVLPASRKGPLGDPFKVNCLTCHQGAYKPLFGVP
MAKDYPALYET

3D structure

PDB

7c9r Cryo-EM structure of a Ca 2+ -bound photosynthetic LH1-RC complex containing multiple alpha beta-polypeptides.

Chain

Resolution

2.82 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	C	Y76 K77 N78 Q80 F90 M94 T98 C107 C110 H111 K124	Y54 K55 N56 Q58 F68 M72 T76 C85 C88 H89 K102
BS02	HEM	C	Y109 Y122 M130 M133 C152 C155 H156 P162 R295	Y87 Y100 M108 M111 C130 C133 H134 P140 R273
BS03	HEM	C	R211 S213 M236 C247 C250 H251 F256 M257 R266 W270	R189 S191 M214 C225 C228 H229 F234 M235 R244 W248
BS04	HEM	C	H144 V145 V150 K265 A272 C307 C310 H311 K316 P317	H122 V123 V128 K243 A250 C285 C288 H289 K294 P295
BS05	MG	C	Q183 E230	Q161 E208
BS06	CA	C	D136 D278 Q282	D114 D256 Q260

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0020037	heme binding

	Biological Process
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0030077	plasma membrane light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7c9r, PDBe:7c9r, PDBj:7c9r
PDBsum	7c9r
PubMed	33009385
UniProt	H8Z3S2

[Back to BioLiP]