Structure of PDB 7bt6 Chain C

Receptor sequence

>7bt6C (length=334) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

PQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYAVS
EKAGHQTSAGAFGNMCRGGRMFAPTKTWRKWNVKVNHNEKRYATASAIAA
TAVASLVLARGHRVEKIPEIPLVVSTDLESIQKTKEAVAALKAVGAHSDL
LKVLKSKKLRAGKGKYRNRRWTQRRGPLVVYAEDNGIVKALRNVPGVETA
NVASLNLLQLAPGAHLGRFVIWTEAAFTKLDQVWGSETVASSKVGYTLPS
HIISTSDVTRIINSSEIQSAIRPAGQATQKRTHVLKKNPLKNKQVLLRLN
PYAKVFAAEKLGSKKAEKTGTKPAAVFTETLKHD

3D structure

PDB

7bt6 Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.

Chain

Resolution

3.12 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R31 H36 K44 N45 K46 R47 Q48 Y50 V52 S53 A56 N92 M93 R95 R98 F100 K108 K112 N114 H115 N116 E117 K118 R119 R138 R141 K161 T162 K180 K186 R188 A189 G190 K191 K193 Y194 R195 R197 R202 R203 Y209 K217 R220 N221 T227 N234 P240 G241 H243 N291 Q296 R300 A302 G303 A305 Q307 K308 R309 V312 K315 Q322 R326 N328 K332 F334 A335 K343 T347 P351	R28 H33 K41 N42 K43 R44 Q45 Y47 V49 S50 A53 N64 M65 R67 R70 F72 K80 K84 N86 H87 N88 E89 K90 R91 R110 R113 K133 T134 K152 K158 R160 A161 G162 K163 K165 Y166 R167 R169 R174 R175 Y181 K189 R192 N193 T199 N206 P212 G213 H215 N263 Q268 R272 A274 G275 A277 Q279 K280 R281 V284 K287 Q294 R298 N300 K304 F306 A307 K315 T319 P323
BS02	rna	C	A49 A51 K193	A46 A48 K165

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7bt6, PDBe:7bt6, PDBj:7bt6
PDBsum	7bt6
PubMed	33037216
UniProt	P10664\|RL4A_YEAST Large ribosomal subunit protein uL4A (Gene Name=RPL4A)

[Back to BioLiP]