Structure of PDB 7aw7 Chain C

Receptor sequence
>7aw7C (length=117) Species: 227321 (Aspergillus nidulans FGSC A4) [Search protein sequence]
TWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLPLARIKKVMK
ADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIAA
ALSKSDMFDFLIDIVPR
3D structure
PDB7aw7 Structural insights into cooperative DNA recognition by the CCAAT-binding complex and its bZIP transcription factor HapX.
ChainC
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K93 K97 M104 I105 S106 R138 K46 K50 M57 I58 S59 R91
BS02 dna C P88 L89 A90 R91 P41 L42 A43 R44
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Feb 21 19:44:42 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7aw7', asym_id = 'C', title = 'Structural insights into cooperative DNA recogni...g complex and its bZIP transcription factor HapX.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7aw7', asym_id='C', title='Structural insights into cooperative DNA recogni...g complex and its bZIP transcription factor HapX.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003677,0046982', uniprot = '', pdbid = '7aw7', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0046982', uniprot='', pdbid='7aw7', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>