Structure of PDB 7asm Chain C

Receptor sequence

>7asmC (length=274) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

AIKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTV
RHHGGGHKRQYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEK
RYIIAPKGLEVGQIVESGAEADIKVGNALPLQNIPVGTVVHNIELKPGKG
GQIARSAGASAQVLGKEGKYVLIRLRSGEVRMILSTCRATIGQVGNLQHE
LVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRPSPMSPWG
KPTLGKKTRRGKKSSDKLIVRGRK

3D structure

PDB

7asm Staphylococcus aureus 50S after 30 minutes incubation a 37C

Chain

Resolution

2.48 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	P8 I9 T10 N11 R14 K35 K39 A41 G42 R43 N44 N45 Q46 K48 L49 T50 R52 H54 H58 K59 R60 Y62 R63 Y83 R87 D98 G99 K147 G149 K150 Q153 I154 A155 R156 S157 A158 K170 Y171 L176 R177 S178 E180 R182 H200 E201 N204 V205 G206 K207 A208 G209 R210 R212 W213 R217 P218 T219 V220 R221 S223 V224 M225 N226 N228 D229 H232 G234 G235 E236 G237 R238 P240 G242 R243 P249 W250 T254 L255 G256 K257 K258 T259 R260 R261 S266 K268 R274	P7 I8 T9 N10 R13 K34 K38 A40 G41 R42 N43 N44 Q45 K47 L48 T49 R51 H53 H57 K58 R59 Y61 R62 Y82 R86 D97 G98 K146 G148 K149 Q152 I153 A154 R155 S156 A157 K169 Y170 L175 R176 S177 E179 R181 H199 E200 N203 V204 G205 K206 A207 G208 R209 R211 W212 R216 P217 T218 V219 R220 S222 V223 M224 N225 N227 D228 H231 G233 G234 E235 G236 R237 P239 G241 R242 P248 W249 T253 L254 G255 K256 K257 T258 R259 R260 S265 K267 R273

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7asm, PDBe:7asm, PDBj:7asm
PDBsum	7asm
PubMed
UniProt	P60430\|RL2_STAA8 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]