Structure of PDB 7ah8 Chain C

Receptor sequence

>7ah8C (length=89) Species: 9606 (Homo sapiens)

EQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASE
RCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFR

3D structure

• PDB: 7ah8 Structural Basis of Inhibition of the Pioneer Transcription Factor NF-Y by Suramin.
• Chain: C
• Resolution: 2.70001 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SVR	C	F139 R140	F88 R89

Gene Ontology

Molecular Function

• GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
• GO:0043565 sequence-specific DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus
• GO:0016602 CCAAT-binding factor complex

External links

• PDB: RCSB:7ah8, PDBe:7ah8, PDBj:7ah8
• PDBsum: 7ah8
• PubMed: 33138093
• UniProt: P25208|NFYB_HUMAN Nuclear transcription factor Y subunit beta (Gene Name=NFYB)