Structure of PDB 7aa9 Chain C

Receptor sequence
>7aa9C (length=118) Species: 9606 (Homo sapiens) [Search protein sequence]
SMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKY
LVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNH
EEDYFLYVAYSDESVYGK
3D structure
PDB7aa9 Phosphorylation of the LIR Domain of SCOC Modulates ATG8 Binding Affinity and Specificity.
ChainC
Resolution1.72 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C K48 Y49 L50 P52 L63 R67 F104 K49 Y50 L51 P53 L64 R68 F105
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0008429 phosphatidylethanolamine binding
GO:0030957 Tat protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0048487 beta-tubulin binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0061723 glycophagy
GO:0097352 autophagosome maturation
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005776 autophagosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aa9, PDBe:7aa9, PDBj:7aa9
PDBsum7aa9
PubMed33845085
UniProtQ9H0R8|GBRL1_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 1 (Gene Name=GABARAPL1)

[Back to BioLiP]