Structure of PDB 7a5h Chain C

Receptor sequence

>7a5hC (length=114) Species: 9606 (Homo sapiens)

PALLSLDENELEEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVKCHQTR
SVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAAKKKQERKKRAKETL
EKKKLLKELWESSK

3D structure

• PDB: 7a5h Elongational stalling activates mitoribosome-associated quality control.
• Chain: C
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	V65 K66 G67 H68 G69 P70 G71 G72 X73 T75 K77 T78 S79 K85 K94 H96 Q97 T98 R99 I111 K129 R132 A134 K136 K138 R141 K142 A145 K146 L149 K152	V16 K17 G18 H19 G20 P21 G22 G23 X24 T26 K28 T29 S30 K36 K45 H47 Q48 T49 R50 I62 K80 R83 A85 K87 K89 R92 K93 A96 K97 L100 K103
BS02	rna	C	R99 Q103	R50 Q54

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003747 translation release factor activity
• GO:0005515 protein binding
• GO:0043023 ribosomal large subunit binding

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination
• GO:0072344 rescue of stalled ribosome

Cellular Component

• GO:0005739 mitochondrion

External links

• PDB: RCSB:7a5h, PDBe:7a5h, PDBj:7a5h
• PDBsum: 7a5h
• PubMed: 33243891
• UniProt: Q9H3J6|MTRFR_HUMAN Mitochondrial translation release factor in rescue (Gene Name=MTRFR)