Structure of PDB 7a0r Chain C

Receptor sequence

>7a0rC (length=197) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]

AQINVIGQNGGRTIELPLPEVNSGVLHEVVTWQLASRRRGTASTRTRAQV
SKTGRKMYGQKGTGNARHGDRSVPTFVGGGVAFGPKPRSYDYTLPRQVRQ
LGLAMAIASRQEGGKLVAVDGFDIADAKTKNFISWAKQNGLDGTEKVLLV
TDDENTRRAARNVSWVSVLPVAGVNVYDILRHDRLVIDAAALEIVEE

3D structure

PDB

7a0r Ribosome-binding and anti-microbial studies of the mycinamicins, 16-membered macrolide antibiotics from Micromonospora griseorubida.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	Q34 L35 R39 R40 T42 S44 T45 R46 Q50 S52 T54 R56 Q61 K62 G63 G65 N66 A67 R68 H69 R72 T76 F77 V78 A83 F84 P86 P88 R89 Y93 T94 P96 R97 Q98 R100 K129 T130 I134 R159 R162 N163 G174 N176 Y178	Q33 L34 R38 R39 T41 S43 T44 R45 Q49 S51 T53 R55 Q60 K61 G62 G64 N65 A66 R67 H68 R71 T75 F76 V77 A82 F83 P85 P87 R88 Y92 T93 P95 R96 Q97 R99 K128 T129 I133 R158 R161 N162 G173 N175 Y177

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7a0r, PDBe:7a0r, PDBj:7a0r
PDBsum	7a0r
PubMed	34417608
UniProt	Q9RXK1\|RL4_DEIRA Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]