Structure of PDB 6zxa Chain C

Receptor sequence
>6zxaC (length=69) Species: 765910 (Marichromatium purpuratum 984) [Search protein sequence]
KVPVMMADESIATINHPEDDWKIWTVINPATWMVPFFGILFVQMWLIHSY
ALSLPGYGFKDSVRVAQPA
3D structure
PDB6zxa The 2.4 angstrom cryo-EM structure of a heptameric light-harvesting 2 complex reveals two carotenoid energy transfer pathways.
ChainC
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 QS2 C P4 V5 M7 F37 P3 V4 M6 F36
BS02 QSE C H17 K23 I24 H16 K22 I23
BS03 BCL C H17 P18 D21 H16 P17 D20
BS04 BCL C F42 M45 H49 F41 M44 H48
BS05 BCL C Q44 I48 H49 Y58 Q43 I47 H48 Y57
BS06 QSE C F37 F38 L41 Q44 Y51 F36 F37 L40 Q43 Y50
BS07 QSE C M45 H49 M44 H48
External links