Structure of PDB 6zi3 Chain C

Receptor sequence

>6zi3C (length=397) Species: 1890 (Streptomyces antibioticus)

ADAVPAYPFSLPHALDLDPHYAELRRDEPVSRVRLPYGEGTAWLVTRMSD
ARIVLGDSRFSTAAATDPATPRMFPTPPEPDGVLAQDPPDHTRLRRLVGK
AFTARRVEEMRPRVRSLVDSLLDDMVAHGSPADLVEFLAVPFPVAVICEL
LGVPLEDRDLFRTFSDAMLSSTRLTAAEIQRVQQDFMVYMDGLVAQRRDA
PTEDLLGALALATDNDDHLTKGEIVNMGVSLLIAGHETSVNQITNLVHLL
LTERKRYESLVADPALVPAAVEEMLRYTPLVSAGSFVRVATEDVELSTVT
VRAGEPCVVHFASANRDEEVFDHADELDFHRERNPHIAFGHGAHHCIGAQ
LGRLELQEALSALVRRFPTLDLAEPVAGLKWKQGMLIRGLERQIVSW

3D structure

• PDB: 6zi3 Dissecting the Cytochrome P450 OleP Substrate Specificity: Evidence for a Preferential Substrate.
• Chain: C
• Resolution: 2.08 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S180 A244 E247 T248 S249 S292 C356 I357 G358 E365 I397
• Catalytic site (residue number reindexed from 1): S170 A234 E237 T238 S239 S282 C346 I347 G348 E355 I387

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	L94 H101 R105 F112 A244 G245 T248 Q252 R298 F321 A348 F349 H354 C356 G358	L84 H91 R95 F102 A234 G235 T238 Q242 R288 F311 A338 F339 H344 C346 G348
BS02	DEB	C	F84 L94	F74 L84
BS03	RAM	C	E89 G92 M178 N236 S240 I243	E79 G82 M168 N226 S230 I233
BS04	RAM	C	Q96 D100 E233	Q86 D90 E223

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

External links

• PDB: RCSB:6zi3, PDBe:6zi3, PDBj:6zi3
• PDBsum: 6zi3
• PubMed: 33036250
• UniProt: Q59819