Structure of PDB 6zga Chain C

Receptor sequence

>6zgaC (length=168) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

HGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTF
DLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAEL
KDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGSQRIEGQRPVEVFMCS
VVMRNGYLEAFQWLSQYI

3D structure

PDB

6zga Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.

Chain

Resolution

4.6 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H77
Catalytic site (residue number reindexed from 1)	H55
Enzyme Commision number	3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	C	D32 N33 A34 G35 K36 T37 T38 P53 N132 K133 V173 V174	D10 N11 A12 G13 K14 T15 T16 P31 N110 K111 V151 V152
BS02	MG	C	K36 T37	K14 T15

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity

	Biological Process
GO:0000266	mitochondrial fission
GO:0003400	regulation of COPII vesicle coating
GO:0006886	intracellular protein transport
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006998	nuclear envelope organization
GO:0007006	mitochondrial membrane organization
GO:0015031	protein transport
GO:0016050	vesicle organization
GO:0016192	vesicle-mediated transport
GO:0061024	membrane organization
GO:0070863	positive regulation of protein exit from endoplasmic reticulum
GO:1902953	positive regulation of ER to Golgi vesicle-mediated transport

	Cellular Component
GO:0000139	Golgi membrane
GO:0005739	mitochondrion
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0012507	ER to Golgi transport vesicle membrane
GO:0016020	membrane
GO:0030127	COPII vesicle coat
GO:0031410	cytoplasmic vesicle
GO:0044233	mitochondria-associated endoplasmic reticulum membrane contact site
GO:0070971	endoplasmic reticulum exit site

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6zga, PDBe:6zga, PDBj:6zga
PDBsum	6zga
PubMed	33795673
UniProt	P20606\|SAR1_YEAST Small COPII coat GTPase SAR1 (Gene Name=SAR1)

[Back to BioLiP]