Structure of PDB 6z7r Chain C

Receptor sequence

>6z7rC (length=279) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough) [Search protein sequence]

GERPPVFWLQGQGCTGCSVTLLNSVHPSIADVLLKVISLEFHPTVMAWEG
EHAIEHMRKVAEKFKGKFFLVIEGSVPVEADGKYCIIGEANHHEISMVDA
LKEFGPNAAAVLAVGTCAAYGGIPAAEGSETGATAVSKFLGDNGIKTPVV
NIPGCPPHPDWIVGTVVLALDAIKKNGLEGGLAEVVKVLDSDGRPTPFFG
RNIHENCPYLDKYDEGVMSATFTDKVGCRYDLGCKGPMTMADCFERKWNG
GVNWCVQNAVCIGCVEPDFPDGKSPFYQA

3D structure

PDB

6z7r Exploring the gas access routes in a [NiFeSe] hydrogenase using crystals pressurized with krypton and oxygen.

Chain

Resolution

1.77 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	C18 C21 C121 C159 H208 C211 C232 C238 C247 C259 C265 C268
Catalytic site (residue number reindexed from 1)	C14 C17 C117 C155 H204 C207 C228 C234 C243 C255 C261 C264
Enzyme Commision number	1.12.2.1: cytochrome-c3 hydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	SF4	C	H208 C211 Y213 L214 C232 R233 Y234 C238 V260	H204 C207 Y209 L210 C228 R229 Y230 C234 V256
BS02	SF4	C	C247 W252 C259 C265 I266 C268	C243 W248 C255 C261 I262 C264
BS03	SF4	C	G17 C18 G20 C21 G119 C121 C159 P160	G13 C14 G16 C17 G115 C117 C155 P156
BS04	6ML	C	C18 G20 C21 E77 G119 C121 C159 P160	C14 G16 C17 E73 G115 C117 C155 P156

Gene Ontology

	Molecular Function
GO:0008901	ferredoxin hydrogenase activity
GO:0051536	iron-sulfur cluster binding

	Cellular Component
GO:0009375	ferredoxin hydrogenase complex

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6z7r, PDBe:6z7r, PDBj:6z7r
PDBsum	6z7r
PubMed	32865640
UniProt	Q72AS4

[Back to BioLiP]