Structure of PDB 6yrj Chain C

Receptor sequence
>6yrjC (length=306) Species: 1200984 (Streptomyces lividans 1326) [Search protein sequence]
EPEPQMVLSPLTSAAIFLVVTIDSGGEDTVRDLLSDVASLERAVGFRAQP
DGRLSCVTGIGSEAWDRLFSGARPAGLHPFRELDGPVHRAVATPGDLLFH
IRASRLDLCFALATEIMGRLRGAVTPQDEVHGFKYFDERDMLGFVDGTEN
PTGAAARRAVLVGAEDPAFAGGSYAVVQKYLHDIDAWEGLSVEAQERVIG
RRKMTDVELSDDVKPADSHVALTSVTGPDGSDLEILRDNMPFGSVGREEF
GTYFIGYARTPEVTETMLERMFLGTASAPHDRILDFSTAVTGSLFFTPAA
DFLEDL
3D structure
PDB6yrj Serial Femtosecond Zero Dose Crystallography Captures a Water-Free Distal Heme Site in a Dye-Decolorising Peroxidase to Reveal a Catalytic Role for an Arginine in Fe IV =O Formation.
ChainC
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM C D146 V151 G153 T154 E155 Y186 R207 H225 T229 R243 F260 M273 L274 M277 I289 D140 V145 G147 T148 E149 Y180 R201 H219 T223 R237 F254 M267 L268 M271 I283
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 01:43:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6yrj', asym_id = 'C', title = 'Serial Femtosecond Zero Dose Crystallography Cap...ytic Role for an Arginine in Fe IV =O Formation. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6yrj', asym_id='C', title='Serial Femtosecond Zero Dose Crystallography Cap...ytic Role for an Arginine in Fe IV =O Formation. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004601,0020037', uniprot = '', pdbid = '6yrj', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004601,0020037', uniprot='', pdbid='6yrj', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>