Structure of PDB 6yly Chain C

Receptor sequence

>6ylyC (length=361) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYA
VSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFA
PTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLV
VSTDLESIQKTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQ
RRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWT
EAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRP
AGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKP
AAVFTETLKHD

3D structure

PDB

6yly Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R31 I34 H36 K44 K46 R47 Q48 Y50 V52 S53 E54 A56 H58 Q59 S61 G68 R69 A70 V71 R73 G78 G80 T82 R84 N92 M93 C94 R95 G96 R98 M99 F100 P102 R107 K112 N114 H115 N116 K118 R119 Y120 R138 R141 K161 T162 K163 L179 K180 K186 L187 R188 A189 G190 K193 Y194 R195 N196 R197 W199 R202 R203 Y209 V216 K217 R220 N221 T227 A231 S232 N234 G241 H243 V272 T287 I290 N291 A305 Q307 K308 R309 V312 K315 K319 N320 Q322 R326 N328 A331 K332 F334 G340 S341 K342 K346 T347 T349 F355	R30 I33 H35 K43 K45 R46 Q47 Y49 V51 S52 E53 A55 H57 Q58 S60 G67 R68 A69 V70 R72 G77 G79 T81 R83 N91 M92 C93 R94 G95 R97 M98 F99 P101 R106 K111 N113 H114 N115 K117 R118 Y119 R137 R140 K160 T161 K162 L178 K179 K185 L186 R187 A188 G189 K192 Y193 R194 N195 R196 W198 R201 R202 Y208 V215 K216 R219 N220 T226 A230 S231 N233 G240 H242 V271 T286 I289 N290 A304 Q306 K307 R308 V311 K314 K318 N319 Q321 R325 N327 A330 K331 F333 G339 S340 K341 K345 T346 T348 F354
BS02	rna	C	A51 K193 Y194	A50 K192 Y193

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6yly, PDBe:6yly, PDBj:6yly
PDBsum	6yly
PubMed	32668200
UniProt	P10664\|RL4A_YEAST Large ribosomal subunit protein uL4A (Gene Name=RPL4A)

[Back to BioLiP]