Structure of PDB 6ycs Chain C

Receptor sequence
>6ycsC (length=68) Species: 9606 (Homo sapiens) [Search protein sequence]
SDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQ
WSQLKEQISDIDDAVRKL
3D structure
PDB6ycs Origins of the Increased Affinity of Phosphorothioate-Modified Therapeutic Nucleic Acids for Proteins.
ChainC
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R75 F77 K78 D91 K97 R100 R16 F18 K19 D32 K38 R41
BS02 rna C F77 L82 R86 W89 P98 G99 R100 K101 F18 L23 R27 W30 P39 G40 R41 K42
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003713 transcription coactivator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0060261 positive regulation of transcription initiation by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ycs, PDBe:6ycs, PDBj:6ycs
PDBsum6ycs
PubMed32202774
UniProtP53999|TCP4_HUMAN Activated RNA polymerase II transcriptional coactivator p15 (Gene Name=SUB1)

[Back to BioLiP]