Structure of PDB 6xwh Chain C

Receptor sequence
>6xwhC (length=80) Species: 9606 (Homo sapiens) [Search protein sequence]
TKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQ
3D structure
PDB6xwh Structural basis for DNA recognition and allosteric control of the retinoic acid receptors RAR-RXR.
ChainC
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K145 H146 Y147 K160 R164 V205 Q206 E208 R209 K15 H16 Y17 K30 R34 V75 Q76 E78 R79
BS02 dna C E153 G154 F158 R161 R184 N185 Q188 R191 R209 E23 G24 F28 R31 R54 N55 Q58 R61 R79
BS03 ZN C C135 C155 C5 C25
BS04 ZN C C171 C177 C187 C190 C41 C47 C57 C60
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6xwh, PDBe:6xwh, PDBj:6xwh
PDBsum6xwh
PubMed32974652
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]