Structure of PDB 6wej Chain C

Receptor sequence
>6wejC (length=513) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
RIRKYLANYTQDPSTDNFYYWTCVVTVAYIYNLLFVIARQVFNDLIGPSS
QSLCRFYNNSTTQVECTYNMLTNMKEMPTYSQYPDLGWSKYWHFRMLWVF
FDLLMDCVYLIDTFLNYRMGYMDQGLVVREAEKVTKAYWQSKQYRIDGIS
LIPLDYILGWPIPYINWRGLPILRLNRLIRYKRVRNCLERTETRSSMPNA
FRVVVVVWYIVIIIHWNACLYFWISEWIGLGTDAWVYGHLNKQSLPDDIT
DTLLRRYVYSFYWSTLILTTIGEVPSPVRNIEYAFVTLDLMCGVLIFATI
VGNVGSMISNMSAARTEFQNKMDGIKQYMELRKVSKQLEIRVIKWFDYLW
TNKQSLSDQQVLKVLPDKLQAEIAMQVHFETLRKVRIFQDCEAGLLAELV
LKLQLQVFSPGDFICKKGDIGREMYIVKRGRLQVVDDDGKKVFVTLQEGS
VFGELSILNIAGSKNGNRRTANVRSVGYTDLFVLSKTDLWNALREYPDAR
KLLLAKGREILKK
3D structure
PDB6wej Mechanism of ligand activation of a eukaryotic cyclic nucleotide-gated channel.
ChainC
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CPL C D147 L148 C172 Y197 F200 W204 F207 D44 L45 C66 Y91 F94 W98 F101
BS02 CPL C T358 Y363 T252 Y257
BS03 CPL C W333 I387 W227 I281
BS04 CPL C L326 W329 L220 W223
BS05 CPL C V290 W314 Y315 V184 W208 Y209
Gene Ontology
Molecular Function
GO:0005216 monoatomic ion channel activity
GO:0005221 intracellularly cyclic nucleotide-activated monoatomic cation channel activity
GO:0005222 intracellularly cAMP-activated cation channel activity
GO:0005223 intracellularly cGMP-activated cation channel activity
GO:0005249 voltage-gated potassium channel activity
GO:0030553 cGMP binding
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
Biological Process
GO:0003031 detection of carbon dioxide
GO:0006811 monoatomic ion transport
GO:0006813 potassium ion transport
GO:0006935 chemotaxis
GO:0007199 G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger
GO:0007399 nervous system development
GO:0007602 phototransduction
GO:0007635 chemosensory behavior
GO:0009454 aerotaxis
GO:0010628 positive regulation of gene expression
GO:0010754 negative regulation of cGMP-mediated signaling
GO:0019722 calcium-mediated signaling
GO:0030516 regulation of axon extension
GO:0034220 monoatomic ion transmembrane transport
GO:0040010 positive regulation of growth rate
GO:0040040 thermosensory behavior
GO:0042048 olfactory behavior
GO:0043052 thermotaxis
GO:0045664 regulation of neuron differentiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048609 multicellular organismal reproductive process
GO:0048812 neuron projection morphogenesis
GO:0050907 detection of chemical stimulus involved in sensory perception
GO:0055085 transmembrane transport
GO:0055093 response to hyperoxia
GO:0070482 response to oxygen levels
GO:0071805 potassium ion transmembrane transport
GO:0098655 monoatomic cation transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0016020 membrane
GO:0017071 intracellular cyclic nucleotide activated cation channel complex
GO:0030425 dendrite
GO:0034703 cation channel complex
GO:0042995 cell projection
GO:0097543 ciliary inversin compartment
GO:0097730 non-motile cilium

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wej, PDBe:6wej, PDBj:6wej
PDBsum6wej
PubMed32483338
UniProtQ03611|CNG_CAEEL Cyclic nucleotide-gated channel (Gene Name=tax-4)

[Back to BioLiP]