Structure of PDB 6wb7 Chain C

Receptor sequence

>6wb7C (length=293) Species: 134676 (Actinoplanes sp. SE50/110)

HTDVLVLGGAGVDTIAYVPELPLPFQDSYVVAAIEPRAGQTGDNVALGLH
TLGLRTMHVDVLGDDPEGDLVRAFHTRHGLPFAALPTAAGTKRAVNLVGP
DGRRLSLWDGSREAEEDRYPAALIAAHTAHARHVHVCITPPGQHVFGQLN
DLPVTVSTDLHNWDGAYEGFEVYAFNADLVFLSATALTDVAATMRRVIDR
GRARLVVATDGAHGGSVLVRGETEVRRYAAVAPEAPVVDSNGAGDAFVSG
FLFGHLAGEPLETCLRYGAIAGAYACTIPATRAGAIDRAALLR

3D structure

• PDB: 6wb7 The human microbiome encodes resistance to the antidiabetic drug acarbose.
• Chain: C
• Resolution: 2.44 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.187: acarbose 7(IV)-phosphotransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLC	C	G113 E116	G110 E113
BS02	GLC	C	I141 F173	I138 F170
BS03	AC1	C	D16 Q43 T44 N99 S109 W111 H164 N165 D248	D13 Q40 T41 N96 S106 W108 H161 N162 D245
BS04	ANP	C	T212 G214 G217 Y231 V234 P236 N244 G245 A246 G247 D248 A272 C279	T209 G211 G214 Y228 V231 P233 N241 G242 A243 G244 D245 A269 C276
BS05	MN	C	D202 G204	D199 G201

Gene Ontology

Molecular Function

• GO:0016301 kinase activity
• GO:0016772 transferase activity, transferring phosphorus-containing groups

Biological Process

• GO:0016310 phosphorylation

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6wb7, PDBe:6wb7, PDBj:6wb7
• PDBsum: 6wb7
• PubMed: 34819672
• UniProt: Q8RMD4|ACBK_ACTS5 Acarbose 7(IV)-phosphotransferase (Gene Name=acbK)