Structure of PDB 6v39 Chain C

Receptor sequence

>6v39C (length=270) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]

QKCKPTSPGRRFVEKVVHDHLHKGAPYAPLVEAKKRTGGRNNNGHITTRH
VGGGHKQHYRIVDFKRNKDGVPAVVERIEYDPNRTAHIALLKYADGERRY
IIAPKGLRAGDKVQSGNDAPIRPGNCLPLRNMPIGSTLHNVELKIGKGAQ
LARSAGASVQLLGRDGSYAIIRLRSGEMRKVHVECRAVIGEVSNQENNLR
SLGKAGAARWRGVRPTVRGMAMNPIDHPHGGGEGRNKGIQPVSPWGQKAK
GYKTRTNKRTTKMIIRDRRV

3D structure

PDB

6v39 Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.

Chain

Resolution

3.04 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	K7 P8 G12 R13 R14 F15 K37 K38 R39 T40 G42 R43 N44 N45 N46 H48 I49 T50 T51 R52 H58 K59 Q60 H61 Y62 R63 Y83 P85 R87 A112 G113 K147 K150 Q153 L154 A155 R156 S157 A158 L176 R177 S178 E180 R182 Q198 N201 G206 K207 A208 G209 R212 W213 R217 P218 T219 V220 R221 M223 A224 M225 N226 I228 D229 G234 G235 E236 R238 N239 K240 G241 Q243 P244 P247 W248 Q250 A252 K253 G254 Y255 K256 T257 R258 R262 T263 K265 R271 V273	K4 P5 G9 R10 R11 F12 K34 K35 R36 T37 G39 R40 N41 N42 N43 H45 I46 T47 T48 R49 H55 K56 Q57 H58 Y59 R60 Y80 P82 R84 A109 G110 K144 K147 Q150 L151 A152 R153 S154 A155 L173 R174 S175 E177 R179 Q195 N198 G203 K204 A205 G206 R209 W210 R214 P215 T216 V217 R218 M220 A221 M222 N223 I225 D226 G231 G232 E233 R235 N236 K237 G238 Q240 P241 P244 W245 Q247 A249 K250 G251 Y252 K253 T254 R255 R259 T260 K262 R268 V270

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6v39, PDBe:6v39, PDBj:6v39
PDBsum	6v39
PubMed	31964740
UniProt	B7IA36\|RL2_ACIB5 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]