Structure of PDB 6uph Chain C

Receptor sequence
>6uphC (length=97) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]
SRSAKAGLTFPVGRVHRLLRKGNYAQRIGSGAPVYLTAVLEYLAAEILEL
AGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIH
3D structure
PDB6uph Cryoelectron Microscopy Structure of a Yeast Centromeric Nucleosome at 2.7 angstrom Resolution.
ChainC
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R18 R33 R2 R17
BS02 dna C R43 I44 T77 R78 R27 I28 T61 R62
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006281 DNA repair
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uph, PDBe:6uph, PDBj:6uph
PDBsum6uph
PubMed32004465
UniProtQ6CK59|H2A_KLULA Histone H2A (Gene Name=HTA1)

[Back to BioLiP]