Structure of PDB 6uag Chain C |
>6uagC (length=94) Species: 226186 (Bacteroides thetaiotaomicron VPI-5482) [Search protein sequence] |
DYIPEPMDLSLVDLPESLIQLSERIAENVHEVWAKARIDEGWTYGEKRDD IHKKHPCLVPYDELPEEEKEADRNTAMNTIKMVKKLGFRIEKED |
|
PDB | 6uag Closed Dimer of Y77A Mutant Putative Ryanodine Receptor from Bacteroides thetaiotaomicron VPI-5482 |
Chain | C |
Resolution | 2.709 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GLC |
C |
H36 D78 |
H30 D72 |
|
|
|
|