Structure of PDB 6u9w Chain C

Receptor sequence
>6u9wC (length=562) Species: 10116 (Rattus norvegicus) [Search protein sequence]
CSWNDVFQYETNKVTRIQSVNYGTIKWILHMTVFSYVSFALMSDKLYQRK
EPLISSVHTKVKGVAEVTENVTEGGVTKLVHGIFDTADYTLPLQGNSFFV
MTNYLKSEGQEQKLCPEYPSRGKQCHSDQGCIKGWMDPQSKGIQTGRCIP
YDQKRKTCEIFAWCPAEEGKEAPRPALLRSAENFTVLIKNNIDFPGHNYT
TRNILPGMNISCTFHKTWNPQCPIFRLGDIFQEIGENFTEVAVQGGIMGI
EIYWDCNLDSWSHRCQPKYSFRRLDDKYTNESLFPGYNFRYAKYYKENGM
EKRTLIKAFGVRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVCIDLI
INTYASTCCRSRVYPSCKCCEPCAVNEYYYRKKCEPIVEPKPTLKYVSFV
DEPHIWMVDQQLLGKSLQDVKGQEVPRPQTDFLELSRLDSPDWCQCGNCL
PSQLPENRRALEELCCRRKPGQCITTSELFSKIVLSREALQLLLLYQEPL
LALEGEAINSKLRHCAYRSYATWRFVSQDMADFAILPSCCRWKIRKEFPK
TQGQYSGFKYPY
3D structure
PDB6u9w Full-Length P2X7Structures Reveal How Palmitoylation Prevents Channel Desensitization.
ChainC
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP C F288 N292 R294 K311 F284 N288 R290 K307
BS02 ATP C K64 K66 T189 V190 L191 K60 K62 T185 V186 L187
BS03 ZN C C479 C572 C446 C539
BS04 ZN C C477 C479 C482 C444 C446 C449
BS05 GDP C R546 Y550 A567 L569 R574 R578 K583 S589 R513 Y517 A534 L536 R541 R545 K550 S556
BS06 Q3G C F38 L341 F344 F34 L337 F340
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0001530 lipopolysaccharide binding
GO:0001614 purinergic nucleotide receptor activity
GO:0004931 extracellularly ATP-gated monoatomic cation channel activity
GO:0005102 signaling receptor binding
GO:0005216 monoatomic ion channel activity
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0015267 channel activity
GO:0038023 signaling receptor activity
GO:0042802 identical protein binding
GO:0043539 protein serine/threonine kinase activator activity
GO:0097110 scaffold protein binding
Biological Process
GO:0000165 MAPK cascade
GO:0000902 cell morphogenesis
GO:0001845 phagolysosome assembly
GO:0001913 T cell mediated cytotoxicity
GO:0001916 positive regulation of T cell mediated cytotoxicity
GO:0002028 regulation of sodium ion transport
GO:0006509 membrane protein ectodomain proteolysis
GO:0006649 phospholipid transfer to membrane
GO:0006811 monoatomic ion transport
GO:0006812 monoatomic cation transport
GO:0006816 calcium ion transport
GO:0006884 cell volume homeostasis
GO:0006900 vesicle budding from membrane
GO:0006954 inflammatory response
GO:0007005 mitochondrion organization
GO:0007009 plasma membrane organization
GO:0007166 cell surface receptor signaling pathway
GO:0009306 protein secretion
GO:0009410 response to xenobiotic stimulus
GO:0009612 response to mechanical stimulus
GO:0009617 response to bacterium
GO:0010043 response to zinc ion
GO:0010467 gene expression
GO:0010524 positive regulation of calcium ion transport into cytosol
GO:0010628 positive regulation of gene expression
GO:0012501 programmed cell death
GO:0014047 glutamate secretion
GO:0014049 positive regulation of glutamate secretion
GO:0014051 gamma-aminobutyric acid secretion
GO:0014054 positive regulation of gamma-aminobutyric acid secretion
GO:0014070 response to organic cyclic compound
GO:0016079 synaptic vesicle exocytosis
GO:0016485 protein processing
GO:0017121 plasma membrane phospholipid scrambling
GO:0019228 neuronal action potential
GO:0019233 sensory perception of pain
GO:0030163 protein catabolic process
GO:0030501 positive regulation of bone mineralization
GO:0032060 bleb assembly
GO:0032308 positive regulation of prostaglandin secretion
GO:0032310 prostaglandin secretion
GO:0032496 response to lipopolysaccharide
GO:0032730 positive regulation of interleukin-1 alpha production
GO:0032731 positive regulation of interleukin-1 beta production
GO:0032755 positive regulation of interleukin-6 production
GO:0032963 collagen metabolic process
GO:0033198 response to ATP
GO:0034220 monoatomic ion transmembrane transport
GO:0034405 response to fluid shear stress
GO:0034767 positive regulation of monoatomic ion transmembrane transport
GO:0035590 purinergic nucleotide receptor signaling pathway
GO:0042098 T cell proliferation
GO:0043029 T cell homeostasis
GO:0043065 positive regulation of apoptotic process
GO:0043132 NAD transport
GO:0043409 negative regulation of MAPK cascade
GO:0043410 positive regulation of MAPK cascade
GO:0045332 phospholipid translocation
GO:0045778 positive regulation of ossification
GO:0045779 negative regulation of bone resorption
GO:0045794 negative regulation of cell volume
GO:0045821 positive regulation of glycolytic process
GO:0046513 ceramide biosynthetic process
GO:0046931 pore complex assembly
GO:0048705 skeletal system morphogenesis
GO:0048873 homeostasis of number of cells within a tissue
GO:0050714 positive regulation of protein secretion
GO:0050830 defense response to Gram-positive bacterium
GO:0051209 release of sequestered calcium ion into cytosol
GO:0051495 positive regulation of cytoskeleton organization
GO:0051592 response to calcium ion
GO:0051602 response to electrical stimulus
GO:0051649 establishment of localization in cell
GO:0051882 mitochondrial depolarization
GO:0051899 membrane depolarization
GO:0051901 positive regulation of mitochondrial depolarization
GO:0060079 excitatory postsynaptic potential
GO:0060907 positive regulation of macrophage cytokine production
GO:0070227 lymphocyte apoptotic process
GO:0070230 positive regulation of lymphocyte apoptotic process
GO:0070231 T cell apoptotic process
GO:0070234 positive regulation of T cell apoptotic process
GO:0070588 calcium ion transmembrane transport
GO:0071359 cellular response to dsRNA
GO:0071407 cellular response to organic cyclic compound
GO:0072593 reactive oxygen species metabolic process
GO:0097190 apoptotic signaling pathway
GO:0097191 extrinsic apoptotic signaling pathway
GO:0098655 monoatomic cation transmembrane transport
GO:0099161 regulation of presynaptic dense core granule exocytosis
GO:1904172 positive regulation of bleb assembly
GO:1904669 ATP export
Cellular Component
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0009897 external side of plasma membrane
GO:0016020 membrane
GO:0031594 neuromuscular junction
GO:0032059 bleb
GO:0032991 protein-containing complex
GO:0043025 neuronal cell body
GO:0043195 terminal bouton
GO:0045202 synapse
GO:0098794 postsynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6u9w, PDBe:6u9w, PDBj:6u9w
PDBsum6u9w
PubMed31587896
UniProtQ64663|P2RX7_RAT P2X purinoceptor 7 (Gene Name=P2rx7)

[Back to BioLiP]