Structure of PDB 6u63 Chain C |
>6u63C (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] |
EDELYRQSLEIISRYLREQATGAGATSRKALETLRRVGDGVQRNHETAFQ GMLRKLDIDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTIN QESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH |
|
PDB | 6u63 Discovery and Characterization of 2,5-Substituted Benzoic Acid Dual Inhibitors of the Anti-apoptotic Mcl-1 and Bfl-1 Proteins. |
Chain | C |
Resolution | 2.75 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
Q0D |
C |
M231 V253 R263 F270 |
M52 V71 R81 F88 |
BindingDB: Ki=220nM |
|
|
|