Structure of PDB 6u2m Chain C

Receptor sequence

>6u2mC (length=464) Species: 1831 (Rhodococcus sp. (in: high G+C Gram-positive bacteria))

IPRLDTLILVKAMGHRKRFGNPFRPKETFQAFRTTDVGRKLIIDQNVFIE
GTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVA
LVEEYMDWLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPG
LNLLQEDNPDLIGSEIARWLSTLEISIGTGFPFDPHYVEVLGERMHYVDV
GPRDGTPVLFLHGNPTSSYVWRNIIPHVAPKHRCIAPDLIGMGKSDKPDL
GYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIA
FMEFIRPIPTWDEWPFARDQLTEEQIAEFKEAFSLFDKDGDGTITTKELG
TVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEE
EIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGD
GQVNYEEFVQMMTA

3D structure

• PDB: 6u2m The HaloTag as a general scaffold for far-red tunable chemigenetic indicators.
• Chain: C
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PUJ	C	T31 L44 Q48 E53 G54 T55 M58 V128 N155 D304	T28 L41 Q45 E50 G51 T52 M55 V125 N152 D279
BS02	CA	C	D362 D364 D366 T368 E373	D337 D339 D341 T343 E348
BS03	CA	C	D398 D400 N402 T404 E409	D373 D375 N377 T379 E384
BS04	CA	C	D435 D437 N439 Y441 E446	D410 D412 N414 Y416 E421
BS05	CA	C	D471 D473 D475 Q477 E482	D446 D448 D450 Q452 E457

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 12:11:19 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6u2m', asym_id = 'C', title = 'The HaloTag as a general scaffold for far-red tunable chemigenetic indicators.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6u2m', asym_id='C', title='The HaloTag as a general scaffold for far-red tunable chemigenetic indicators.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003824,0005509', uniprot = '', pdbid = '6u2m', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003824,0005509', uniprot='', pdbid='6u2m', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>