Structure of PDB 6tyn Chain C |
>6tynC (length=114) Species: 90370 (Salmonella enterica subsp. enterica serovar Typhi) [Search protein sequence] |
EWTGDNTNAYYSDEVISELHVGQIDTSPYFCIKTVKANGSGTPVVACAVS KQSIWAPSFKELLDQARYFYSTGQSVRIHVQKNIWTYPLFVNTFSANALV GLSSCSATQCFGPK |
|
PDB | 6tyn The role of 9-O-acetylated glycan receptor moieties in the typhoid toxin binding and intoxication. |
Chain | C |
Resolution | 2.33 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5N6 |
C |
Y33 Y34 S35 K59 |
Y10 Y11 S12 K36 |
|
|
|
|